PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g478180.1
Common NameMTR_4g478180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB
Protein Properties Length: 354aa    MW: 39560.4 Da    PI: 6.8387
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g478180.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.82.5e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv+ +k++G g+W++ ++  g++R++k+c++rw +yl
  Medtr4g478180.1 15 KGPWTPEEDRILVNHIKKHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding543.8e-1768113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +T eE++ ++++++ lG++ W++Ia +++ gRt++++k++w+++l
  Medtr4g478180.1  68 RGQFTDEEEKTIINLHAVLGNK-WSAIAGHLP-GRTDNEIKNFWNTHL 113
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-26665IPR009057Homeodomain-like
PROSITE profilePS5129418.2931062IPR017930Myb domain
SuperFamilySSF466891.48E-3112109IPR009057Homeodomain-like
SMARTSM007171.3E-151464IPR001005SANT/Myb domain
PfamPF002491.2E-161562IPR001005SANT/Myb domain
CDDcd001679.56E-131762No hitNo description
PROSITE profilePS5129425.90163117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2766117IPR009057Homeodomain-like
SMARTSM007172.5E-1567115IPR001005SANT/Myb domain
PfamPF002491.1E-1568113IPR001005SANT/Myb domain
CDDcd001674.75E-1271113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MMGRAPCCDE SGLKKGPWTP EEDRILVNHI KKHGHGSWRA LPKLAGLNRC GKSCRLRWTN  60
YLRPDIKRGQ FTDEEEKTII NLHAVLGNKW SAIAGHLPGR TDNEIKNFWN THLKKKLLQM  120
GLDPVTHRPR IDHLNLMTNL QQLLAANVLN YLPNTWDTAT TNALRLQSDA TKFQLLQNMV  180
QIHALSANIP AHTSNLQLLN PFGQSSSSSQ QENFFNELLG LNQSNFASQN QCNFQSFQVP  240
QMQQVLSNGY QFMDNGGSSN SSSCLKSDQK VDEVFDATNS SSTVPINSLP NLVSVSPECS  300
SVKEMMGNKV NQNDCSNPSS TSTTFEMLGD FMYEDVSDAY WKDLLDQDPT LQP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-30131175108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1086511e-119AB108651.1 Glycine max MYB101 mRNA for transcription factor MYB101, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013456644.10.0myb transcription factor
TrEMBLA0A072UXR80.0A0A072UXR8_MEDTR; Myb transcription factor
STRINGGLYMA12G01960.11e-159(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.27e-97myb domain protein 9
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]